PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf08355g04023.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 349aa    MW: 37881.6 Da    PI: 7.9625
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf08355g04023.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.73e-392786362
                    zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                              e +l+cprCds ntkfCyynnyslsqPr+fCk+CrryWtkGGalrnvP+Ggg+rknkk +
  Niben101Scf08355g04023.1 27 EPSLNCPRCDSPNTKFCYYNNYSLSQPRHFCKTCRRYWTKGGALRNVPIGGGCRKNKKIK 86
                              56789****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-271884IPR003851Zinc finger, Dof-type
PfamPF027013.5E-332984IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.4223084IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103268IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MTNLDNKEES QSSGGGGRKT SATRPQEPSL NCPRCDSPNT KFCYYNNYSL SQPRHFCKTC  60
RRYWTKGGAL RNVPIGGGCR KNKKIKTSCS SRLSGDSKDT SVSSDIGRLQ FFHGLSPAMD  120
FQLGGLNFPR LSSNTSTSGS IFNQFSSFGD ISTTFAAAIG SSSCFSLDPS GSCSGSLLGF  180
NNFPFLSSMV KQGDGGVEEM GSMGIHHGAM ASSIESLSSI NQDLHWKLQQ QRLAMLFGGV  240
SSPVPHLDQN QIQKPQPILF QNLDISSKQQ EEEAAVFGNN INPRKDHGSG NDHGNNNLAT  300
EWFFDNSFGT VNPTSTNSSS GNANDQNNNN NNWNSMQAWS NLNQYSTLP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009774290.10.0PREDICTED: dof zinc finger protein DOF5.7
TrEMBLK4D5Q21e-156K4D5Q2_SOLLC; Uncharacterized protein
STRINGSolyc11g010940.1.11e-155(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52422234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.12e-54Dof family protein